DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and nkx1.2la

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_997995.2 Gene:nkx1.2la / 405755 ZFINID:ZDB-GENE-040615-1 Length:270 Species:Danio rerio


Alignment Length:72 Identity:35/72 - (48%)
Similarity:49/72 - (68%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            ||:|.||||:..||:.||:.|.:.:|:...||..||.:|:|:|||||:||||||||.|:.....|
Zfish   140 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGVE 204

  Fly   452 KGGEGGS 458
            ...:.|:
Zfish   205 SSLQAGT 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 30/55 (55%)
nkx1.2laNP_997995.2 Homeodomain 142..198 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.