DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and ventx1.2

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:63 Identity:34/63 - (53%)
Similarity:45/63 - (71%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            :|:||||:|.|:.:||.||...:|:..:|||.||.:|.|||.|||.||||||.|.||..|:.:
 Frog   128 RRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQDQQ 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 31/55 (56%)