DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and shox2

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_957490.1 Gene:shox2 / 394171 ZFINID:ZDB-GENE-040426-1457 Length:299 Species:Danio rerio


Alignment Length:67 Identity:29/67 - (43%)
Similarity:41/67 - (61%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            |.:|.||.|:..||.:||..|:...|.....|:.|:|.|.|||.:|:|||||||.|.::.:.:..
Zfish   107 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLH 171

  Fly   452 KG 453
            ||
Zfish   172 KG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
shox2NP_957490.1 Homeodomain 109..165 CDD:459649 26/55 (47%)
OAR 278..295 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.