DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and NKX1-2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:319 Identity:76/319 - (23%)
Similarity:101/319 - (31%) Gaps:132/319 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PPAMEQAENPAQRIQPPHTPPKSVSPQSSQPSSS--PTLLISSPHATPP-------------QQQ 234
            |....:|..||.|..|..........::.:.:||  |...:.:|.|..|             :::
Human    28 PQKFTRAALPAVRPAPREARKSLAEVEAGKDASSRDPVRQLETPDAAGPGAGQASPLEGSEAEEE 92

  Fly   235 QQQPPPNYP----KPAMMHPGGAGPMMMPGMPPAGLV--RPFPMGPGGP-PMPQGQPGLPDIKAL 292
            :....|..|    :.|.:.||.|   ..|..|...|.  .|...|.||| ..|.|.||       
Human    93 EDAEDPRRPRLRERAARLLPGLA---RSPDAPAGALASGEPCEDGGGGPVRSPPGSPG------- 147

  Fly   293 PPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDS 357
                                                                   .|.|...|  
Human   148 -------------------------------------------------------SPRPRRRR-- 155

  Fly   358 YQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALA 422
                                   |.|...||:|.||||:..||:.||:.|.:.:|:...||..||
Human   156 -----------------------LEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLA 197

  Fly   423 QNLNLSETQVKVWFQNRRTKHKRMQ--------------QEDEKGGEGGSQRNMHNGSG 467
            .:|:|:|||||:||||||||.|:..              |....||.||      .|||
Human   198 LSLSLTETQVKIWFQNRRTKWKKQNPGADGAAQVGGGAPQPGAAGGGGG------GGSG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 29/51 (57%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 35/218 (16%)
Homeobox 167..219 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.