DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and gsb

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:60 Identity:26/60 - (43%)
Similarity:36/60 - (60%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR 445
            ||.:|.||.||..|:..||..|...||.....|:.|||:..|:|.:|:|||.|||.:.::
  Fly   183 RKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 24/55 (44%)
gsbNP_523863.1 PAX 19..143 CDD:128645
Homeodomain 186..242 CDD:459649 24/55 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.