DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Dll

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001137759.1 Gene:Dll / 37973 FlyBaseID:FBgn0000157 Length:347 Species:Drosophila melanogaster


Alignment Length:254 Identity:68/254 - (26%)
Similarity:97/254 - (38%) Gaps:77/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHV------LGPAA 332
            |..|..|:...|.....::.|.||.|.:         .|..:.|..||...|.:      .||  
  Fly     4 PDAPHTPKYMDGGNTAASVTPGINIPGK---------SAFVELQQHAAAGYGGIRSTYQHFGP-- 57

  Fly   333 AAAAAAGLP-PHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKP-------- 388
            .....:|.| |.:|...|.|.|.::||..|            |.  ||: .||...|        
  Fly    58 QGGQDSGFPSPRSALGYPFPPMHQNSYSGY------------HL--GSY-APPCASPPKDDFSIS 107

  Fly   389 -----------------KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWF 436
                             ::.||.:|..||.:|...|:..||:...||..||.:|.|::||||:||
  Fly   108 DKCEDSGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWF 172

  Fly   437 QNRRTKHKRMQQEDEKGGEG-GSQRNMHNGSGDEDDDELIDMEMDECPSDEEHELDASH 494
            ||||:|:|:|.    |..:| |:...|..|.|.              |:..:|..:..|
  Fly   173 QNRRSKYKKMM----KAAQGPGTNSGMPLGGGG--------------PNPGQHSPNQMH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 26/51 (51%)
DllNP_001137759.1 Homeobox 127..180 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.