DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and inv

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster


Alignment Length:69 Identity:15/69 - (21%)
Similarity:28/69 - (40%) Gaps:14/69 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GILGGIGKMLESKIDTINVPAEMVMGKWFQMYKAAMNFDVVRTTMFCPVAYFS-PNPIMGEEGFS 141
            |:...:|.:..:|...:|:..            .|.|..|:..:.. |.:|.| |.||:...|..
  Fly    14 GLAESLGNVEANKRRALNIRT------------GANNIGVLPASKM-PTSYPSLPAPIVPSPGAP 65

  Fly   142 MQEA 145
            :|::
  Fly    66 IQQS 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649
invNP_523699.3 Homeodomain 472..528 CDD:459649
Engrail_1_C_sig 529..554 CDD:431338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.