Protein Alignment ems and pnx

DIOPT Version :9

• Sequence 1: NP_731868.1
• Gene: ems / 41697
• FlyBaseID: FBgn0000576
• Length: 494
• Species: Drosophila melanogaster
• Sequence 2: NP_840087.1
• Gene: pnx / 352939
• ZFINID: ZDB-GENE-030328-42
• Length: 182
• Species: Danio rerio
• Alignment Length: 75
• Identity: 39/75 - (52%)
• Similarity: 50/75 - (66%)
• Gaps: 5/75 - (6%)

  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            |.|||||||:..||..||.:|:|:.|:...||..:|..|.|||||||:||||||||.|:     |
Zfish    66 KSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKK-----E 125

  Fly   452 KGGEGGSQRN 461
            ..|.||.:::
Zfish   126 LDGHGGEEQS 135

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
ems	NP_731868.1	Homeobox	392..444	CDD:278475	30/51 (59%)
pnx	NP_840087.1	Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490	1..34
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	24..63
		Homeobox	71..123	CDD:278475	30/51 (59%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000921
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24340
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	4	4.010