powered by:
Protein Alignment ems and pnx
DIOPT Version :9
Sequence 1: | NP_731868.1 |
Gene: | ems / 41697 |
FlyBaseID: | FBgn0000576 |
Length: | 494 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_840087.1 |
Gene: | pnx / 352939 |
ZFINID: | ZDB-GENE-030328-42 |
Length: | 182 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 39/75 - (52%) |
Similarity: | 50/75 - (66%) |
Gaps: | 5/75 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
|.|||||||:..||..||.:|:|:.|:...||..:|..|.|||||||:||||||||.|: |
Zfish 66 KSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKK-----E 125
Fly 452 KGGEGGSQRN 461
..|.||.:::
Zfish 126 LDGHGGEEQS 135
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000921 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24340 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.010 |
|
Return to query results.
Submit another query.