DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and scro

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:367 Identity:74/367 - (20%)
Similarity:116/367 - (31%) Gaps:136/367 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 HPHPHLSPAQQ----HVLHQHLLMQQQHPGTPKSHQDIQELLQRLHHNAAMASGLSPLQTRLSPE 167
            |.|.:||....    |..||..|....| .||.|..||                |||:       
  Fly    85 HHHHNLSSIHHLQNLHSQHQSTLFNSNH-STPFSVTDI----------------LSPI------- 125

  Fly   168 TEQPQMAVSLKRERSPAPPAMEQAENPAQRIQPPHTPPKSVSPQSSQPS-SSPTLLISSPHATPP 231
                                    |...::::....||......||..| :||..|.:|..|.| 
  Fly   126 ------------------------EESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMANP- 165

  Fly   232 QQQQQQPPPNYPKPAMMHPGG----AGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKAL 292
                      |....:.|..|    .||  ...:..||                   ...|::..
  Fly   166 ----------YAMGTLYHSPGVQTYCGP--TDNLSLAG-------------------HYTDMRNS 199

  Fly   293 PPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDS 357
            ..:..:     ..::|....:.....:|:....| :|..:..||.:.......||          
  Fly   200 ASWYGS-----TANDPRFAISRLMSSSASGTMSH-MGNMSGLAACSVSDSKPLQF---------- 248

  Fly   358 YQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALA 422
                                      |..:.::.|..|:.:|:.:||..|:..:|:...||:.||
  Fly   249 --------------------------PLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLA 287

  Fly   423 QNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464
            ..::|:.||||:||||.|.|.||..:|     :..:::|.||
  Fly   288 SLIHLTPTQVKIWFQNHRYKCKRQAKE-----KAMAEQNQHN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 22/51 (43%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.