DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and HOXC5

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:186 Identity:59/186 - (31%)
Similarity:79/186 - (42%) Gaps:56/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 INAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMP-NPGM-----A 354
            |..||. .|.::.|.:     .|||..:| |...||.:||||.|..|...:..| ||||     |
Human    47 ITFPPP-APSNSLHGV-----DMAANPRA-HPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAA 104

  Fly   355 RDSY------------------------------QLYPWLLSRHGRIFPHRFPGSFLVPPFRKPK 389
            |.:.                              |:|||:...|   ..|...|          |
Human   105 RPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLH---MSHETDG----------K 156

  Fly   390 RIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKR 445
            |.||:::..|.|:||..|..|:|:....|..:|.||.|:|.|:|:||||||.|.|:
Human   157 RSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 18/73 (25%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeodomain 156..212 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.