DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and vnd

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster


Alignment Length:543 Identity:129/543 - (23%)
Similarity:185/543 - (34%) Gaps:157/543 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MIPP-----VPTA--AAAVMMPTP---------KQKIGFSIESIV---GNDV------STAGGNS 43
            ::||     :|.|  .||:....|         .|:.||.|..|:   |:::      :.|..:.
  Fly   162 LLPPWNHALLPAAFYPAALRNALPGLFDAKVPSSQRSGFHISDILNLEGSELKNAAAAAAAAAHH 226

  Fly    44 TPDLS--GPQSPPPGERNVPGSPPQTPPATLTLIP------------------GSPPHHLM---- 84
            ..|||  .......|.|   |....|.|:.|:..|                  |...||..    
  Fly   227 GSDLSHHSASESTSGHR---GQGSHTSPSALSPTPAGVSADEHHNGSGTGGGAGEADHHSTTEHH 288

  Fly    85 APPAHGLPYPHPHAQQQHLQAPHPHPHLSPAQQHVLHQH----LLMQQQHPGTPKSHQDIQELLQ 145
            |||:|. ...|||.||.|      ||||...|||  ||.    |.:.....|..:||........
  Fly   289 APPSHP-QQQHPHHQQHH------HPHLLLPQQH--HQQAVAPLPLAHHQSGEAQSHAHANAAAA 344

  Fly   146 RL--HHNAAMASGLSPLQTRLS-PETEQPQMAVSLKRERSPAPPAMEQA-------ENPAQRIQP 200
            .|  .||||.|:.::..|...: |:.........:......|...::.:       ||.....|.
  Fly   345 HLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELYGTQQ 409

  Fly   201 PHTPPKSVSPQSSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAG 265
            | ..|.|.||.:|:.|.  |.:.|:...:|......:   :|.:.|.......|..:......:|
  Fly   410 P-ASPDSTSPVTSEVSY--TYIGSNCQTSPALSGDYK---SYSRSADSDALSVGDALHTLHGSSG 468

  Fly   266 LVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGH---- 326
                  .|..|        |.|...||....|.    ...:|.|.:.|.....|.   :||    
  Fly   469 ------NGSAG--------GAPTAHALHNNNNN----TTNNNNHSLKAEGINGAG---SGHDDSL 512

  Fly   327 -------VLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPP 384
                   .:.....|..:.|...:.:..:||                                  
  Fly   513 NEDGIEEDIDDVDDADGSGGGDANGSDGLPN---------------------------------- 543

  Fly   385 FRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQE 449
             :|.|| |..|:.:|..:||..|...:|:...||:.||..:.|:.||||:||||.|.|.||.|  
  Fly   544 -KKRKR-RVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQ-- 604

  Fly   450 DEKGGEG------GSQRNMHNGS 466
            :|||.||      |...:.|:.|
  Fly   605 NEKGYEGHPGLLHGHATHPHHPS 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 22/51 (43%)
vndNP_476786.2 Homeobox 548..601 CDD:278475 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.