DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and nkx2.5

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571496.2 Gene:nkx2.5 / 30696 ZFINID:ZDB-GENE-980526-321 Length:314 Species:Danio rerio


Alignment Length:67 Identity:31/67 - (46%)
Similarity:43/67 - (64%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQ 447
            |..||.::.|..||.:|:.:||..|:..:|:...||..||..|.|:.||||:||||||.|.||.:
Zfish   136 PKQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLTSTQVKIWFQNRRYKCKRQR 200

  Fly   448 QE 449
            |:
Zfish   201 QD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 25/55 (45%)
nkx2.5NP_571496.2 Homeodomain 142..198 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.