powered by:
Protein Alignment ems and Nkx3-1
DIOPT Version :9
Sequence 1: | NP_731868.1 |
Gene: | ems / 41697 |
FlyBaseID: | FBgn0000576 |
Length: | 494 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001029316.1 |
Gene: | Nkx3-1 / 305999 |
RGDID: | 1305369 |
Length: | 238 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 34/65 - (52%) |
Similarity: | 45/65 - (69%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 389 KRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKG 453
||.|.|||.:|:::||..|...:|:...||..||:||.|:|||||:||||||.|.||.|..::.|
Rat 127 KRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRRQLSEDLG 191
Fly 454 453
Rat 192 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.