DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx2a

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:68 Identity:31/68 - (45%)
Similarity:45/68 - (66%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            |||::   ||.:|..||..|:..|:..||:...||..||.:|.|::||||:||||||:|.|::.:
Zfish   123 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWK 187

  Fly   449 EDE 451
            ..|
Zfish   188 SGE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 27/58 (47%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:463567
Homeodomain 128..184 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.