Sequence 1: | NP_731868.1 | Gene: | ems / 41697 | FlyBaseID: | FBgn0000576 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571380.1 | Gene: | dlx1a / 30568 | ZFINID: | ZDB-GENE-990415-48 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 226 | Identity: | 56/226 - (24%) |
---|---|---|---|
Similarity: | 86/226 - (38%) | Gaps: | 71/226 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 289 IKALPPYINAPPE--------LPP--QHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPH 343
Fly 344 AAQFMPNPGMARD----------SYQLYPWLLSRHGRIFPH------------------------ 374
Fly 375 ---RFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWF 436
Fly 437 QNRRTKHKRMQQEDEKGGEGGSQRNMHNGSG 467 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ems | NP_731868.1 | Homeobox | 392..444 | CDD:278475 | 25/51 (49%) |
dlx1a | NP_571380.1 | COG5576 | <124..233 | CDD:227863 | 34/89 (38%) |
Homeobox | 131..184 | CDD:278475 | 26/55 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |