DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx4a

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571375.1 Gene:dlx4a / 30561 ZFINID:ZDB-GENE-980526-73 Length:250 Species:Danio rerio


Alignment Length:185 Identity:50/185 - (27%)
Similarity:74/185 - (40%) Gaps:58/185 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 QHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHG 369
            ||:|. ::.|.:.:....|..|....||.:..||.                     |...|:.|.
Zfish    32 QHSPG-VSHAHYPVHGLHQGAHSQYDAAFSPGAAS---------------------YSRPLAYHY 74

  Fly   370 RIFPHRFPGSFLVPPFR------------------------------KPKRI---RTAFSPSQLL 401
            .. .|..||::|  |::                              |.|:|   ||.:|..||.
Zfish    75 ST-AHHHPGAYL--PYQHNSAVGYSRVEDADSEKQSSIESGEIRLNGKGKKIRKPRTIYSSLQLQ 136

  Fly   402 KLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEG 456
            .|...|:..||:...||..||..|.|::||||:||||:|:|:|::.:....|.||
Zfish   137 ALNQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 25/51 (49%)
dlx4aNP_571375.1 COG5576 98..206 CDD:227863 32/94 (34%)
Homeobox 126..179 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..202 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.