DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx2b

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571372.1 Gene:dlx2b / 30557 ZFINID:ZDB-GENE-980526-18 Length:276 Species:Danio rerio


Alignment Length:165 Identity:54/165 - (32%)
Similarity:75/165 - (45%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 QAGHVLGPAAAAAAAAGLPP------HAAQFMPNPGMARDSYQLYPWLLSRHGR------IFPHR 375
            |.||..|.|.|..|:....|      |.:....:.|.| .||..|    ..:|.      ..|.:
Zfish    49 QTGHCAGTAYAQLASYSYHPGTVGNVHYSPKAYDLGYA-SSYGAY----GTYGASSSPTPTEPEK 108

  Fly   376 FPGSFLVPPFR----KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVK 433
            ....   |..|    |||::   ||.:|..||..|:..|:..||:...||..||.:|.|::||||
Zfish   109 EESE---PEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVK 170

  Fly   434 VWFQNRRTKHKRMQQEDEKGGEGGSQRNMHNGSGD 468
            :||||||:|.|::.    |.||..:.:.:  .|||
Zfish   171 IWFQNRRSKFKKLW----KNGEIPADQQV--ASGD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 26/51 (51%)
dlx2bNP_571372.1 DLL_N 29..102 CDD:289198 15/57 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..123 4/28 (14%)
Homeobox 128..181 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..238 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.