DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and emx2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:311 Identity:103/311 - (33%)
Similarity:136/311 - (43%) Gaps:94/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 QPPHTPPKSVSPQSSQPSSSPTLLISSPHATPPQQQQQQPPP---NYPKPAMMHP-------GGA 253
            ||  ||.:..:.:|         |::..:..|..:.::...|   :|...:.|:|       .|.
Zfish     3 QP--TPKRCFTIES---------LVAKDNPLPSSRSEEPIRPAALSYANSSQMNPFLNGFHSSGR 56

  Fly   254 GPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQM 318
            |....||:       .|......||    ...:|.....||:..|...|...|:||.:.|:|   
Zfish    57 GVYSNPGL-------VFAEAVSHPP----NSAVPVHSVPPPHALAAHPLSSSHSPHPLFASQ--- 107

  Fly   319 AAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRF------P 377
                                               .||....||||:.|: |...|||      |
Zfish   108 -----------------------------------QRDPSTFYPWLIHRY-RYLGHRFQGNETSP 136

  Fly   378 GSFLV--PPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRR 440
            .|||:  ...||||||||||||||||:||||||.|.||||||||.||.:|:|:||||||||||||
Zfish   137 ESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRR 201

  Fly   441 TKHKRMQQEDEKGGEGGSQRNMHN----------GSGDEDDDELIDMEMDE 481
            ||.||.:.|:|.......::..|:          ||.:|     ||:..|:
Zfish   202 TKFKRQKLEEEGSDSQQKKKGTHHINRWRLATKQGSPEE-----IDVTSDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 43/51 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm6489
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.