DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and msx1b

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571335.1 Gene:msx1b / 30511 ZFINID:ZDB-GENE-980526-26 Length:257 Species:Danio rerio


Alignment Length:84 Identity:41/84 - (48%)
Similarity:50/84 - (59%) Gaps:12/84 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 SFLVPP---------FRKPK---RIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQ 431
            ||..||         .||.|   :.||.||.||||.||..|...||:..|||...:.:|||:|||
Zfish   118 SFTSPPRHPSPTPCTLRKHKTNRKPRTPFSTSQLLSLERKFRQKQYLSIAERAEFSNSLNLTETQ 182

  Fly   432 VKVWFQNRRTKHKRMQQED 450
            ||:||||||.|.||:|:.:
Zfish   183 VKIWFQNRRAKAKRLQEAE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 31/51 (61%)
msx1bNP_571335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 9/27 (33%)
Homeobox 142..195 CDD:278475 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.