DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and otx2b

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571326.1 Gene:otx2b / 30501 ZFINID:ZDB-GENE-980526-406 Length:289 Species:Danio rerio


Alignment Length:70 Identity:29/70 - (41%)
Similarity:45/70 - (64%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQED 450
            ||.:|.||.|:.:||..||..|...:|.....|:.:|..:||.|::|:|||:|||.|.::.||:.
Zfish    36 RKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQ 100

  Fly   451 EKGGE 455
            :.||:
Zfish   101 QNGGQ 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 23/55 (42%)
otx2bNP_571326.1 Homeodomain 39..94 CDD:459649 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..142 4/13 (31%)
TF_Otx 153..234 CDD:427350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.