DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and otx1

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571325.2 Gene:otx1 / 30500 ZFINID:ZDB-GENE-980526-400 Length:323 Species:Danio rerio


Alignment Length:108 Identity:39/108 - (36%)
Similarity:53/108 - (49%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 PPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEH 405
            ||:|...:...|.|.|       ||        |...|....|  ||.:|.||.|:.|||..||.
Zfish     8 PPYAMNGLGLSGAAMD-------LL--------HPSVGYPATP--RKQRRERTTFTRSQLDILEA 55

  Fly   406 AFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            .|...:|.....|:.:|..:||.|::|:|||:|||.|.::.||
Zfish    56 LFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQ 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 24/55 (44%)
otx1NP_571325.2 Homeodomain 39..95 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..155 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..204
TF_Otx 172..258 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..277
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.