DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and rx3

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:65 Identity:30/65 - (46%)
Similarity:42/65 - (64%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 PFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            |.:|.:|.||.|:..||.:||.|||.:.|.....|:.||..:||.|.:|:|||||||.|.:|.::
Zfish   102 PKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEK 166

  Fly   449  448
            Zfish   167  166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 27/55 (49%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 2/4 (50%)
Homeodomain 107..163 CDD:459649 27/55 (49%)
OAR 268..284 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.