DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Cdx4

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:287 Identity:70/287 - (24%)
Similarity:102/287 - (35%) Gaps:85/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGG--AGPMMMPGMPPAGLVRPFPMGP 274
            |..|:|:.|.....||..           .||..:.|.|.|  .|....|..||......:|   
  Rat    37 SPLPASNFTAAPVYPHYM-----------GYPHMSNMDPHGPSLGAWSSPYSPPREDWSTYP--- 87

  Fly   275 GGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAA- 338
             ||....|...:.|:.:..|...:|..                        ..|||...|..|: 
  Rat    88 -GPSSTMGTVPMNDMTSSSPAFGSPDY------------------------STLGPTGGAGGASN 127

  Fly   339 --GLPPHAAQFM-----------PNPGMARDSYQLYPWL---LSRHGRIFPHRFPGSFLVPPFRK 387
              .||..|::.:           .:|..:|.|  .|.|:   :...|:.              |.
  Rat   128 GGSLPDAASESLVSIDSGTSGGATSPSRSRHS--PYAWMRKTVQVTGKT--------------RT 176

  Fly   388 PKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM-----Q 447
            .::.|..::..|.|:||..|..|:|:....:..||.||.|||.|||:||||||.|.::|     .
  Rat   177 KEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKIS 241

  Fly   448 QEDEKGGEGGSQRNMHNGSGDEDDDEL 474
            |.:..||      ::.:.||.....||
  Rat   242 QFENSGG------SVQSDSGSISPGEL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 25/51 (49%)
Cdx4NP_001100412.1 Caudal_act 13..166 CDD:398418 35/169 (21%)
Homeobox 181..234 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.