DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Nkx1-2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:157 Identity:55/157 - (35%)
Similarity:71/157 - (45%) Gaps:41/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 AAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMP-NPGMARDSYQLYPWLLSRHGRIFPHRF 376
            |.:.|.....|..|. |...|.|.|.|.....|..:| :||.                       
  Rat    98 AGRAQRPERWQGAHA-GSLEAGAVAVGTEESGADGLPASPGS----------------------- 138

  Fly   377 PGSFLVP-PFR--------KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQV 432
            |||   | |.|        ||:|.||||:..||:.||:.|.:.:|:...||..||.:|:|:||||
  Rat   139 PGS---PRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQV 200

  Fly   433 KVWFQNRRTKHKRMQQEDEKGGEGGSQ 459
            |:||||||||.|:    ...|.:|..|
  Rat   201 KIWFQNRRTKWKK----QNPGADGAVQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 29/51 (57%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.