DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Urad

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001034767.1 Gene:Urad / 231903 MGIID:3647519 Length:178 Species:Mus musculus


Alignment Length:78 Identity:19/78 - (24%)
Similarity:27/78 - (34%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PHAQQQHLQAPHPHPHLSPAQQHVLHQHLLMQQQHPGTPKSHQDIQELLQRLHHNAAMASGLS-P 159
            |.:.|:.:...||.......||..|......:|...|......|.:..||:|:.......|.. .
Mouse    56 PRSGQEGILRCHPDLAGRDLQQGTLTAESQREQSQAGLTSLDTDDRLRLQQLNAQYRERFGFPFV 120

  Fly   160 LQTRLSPETEQPQ 172
            |..|||.....|:
Mouse   121 LAARLSDRATVPR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475
UradNP_001034767.1 OHCU_decarbox 10..162 CDD:286439 19/78 (24%)
Substrate binding. /evidence=ECO:0000250 84..88 0/3 (0%)
Substrate binding. /evidence=ECO:0000250 119..123 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.