DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and EMX1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_004088.2 Gene:EMX1 / 2016 HGNCID:3340 Length:290 Species:Homo sapiens


Alignment Length:300 Identity:105/300 - (35%)
Similarity:129/300 - (43%) Gaps:84/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RIQPPHTPPKSVSPQSSQPSSSPTLLISS------------------PH--ATPPQQQQQQPPP- 240
            |.:.|.|.|.:.:  ..||::.....|.|                  .|  |....::..:|.. 
Human    21 RARLPRTAPAAAT--MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTAL 83

  Fly   241 NYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQ 305
            |||     ||..|....:.|.|.|..........|||.:           ..|..:|.|      
Human    84 NYP-----HPSAAEAAFVSGFPAAAAAGAGRSLYGGPEL-----------VFPEAMNHP------ 126

  Fly   306 HNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHA---AQFMPNPGMARDSYQLYPWLLSR 367
                         |..:...|.||      |:...|||:   ||.       ||....|||:|  
Human   127 -------------ALTVHPAHQLG------ASPLQPPHSFFGAQH-------RDPLHFYPWVL-- 163

  Fly   368 HGRIFPHRF-------PGSFLVPPF-RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQN 424
            ..|.|.|||       .|..|..|| ||||||||||||||||:||.|||.|.||||||||.||.:
Human   164 RNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGS 228

  Fly   425 LNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464
            |:||||||||||||||||:||.:.|:|.......::..|:
Human   229 LSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
EMX1NP_004088.2 COG5576 140..>251 CDD:227863 71/119 (60%)
Homeobox 196..248 CDD:278475 43/51 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 31/40 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4276
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8552
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.