DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and ceh-16

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:143 Identity:43/143 - (30%)
Similarity:65/143 - (45%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 AAAAAGLPPHAAQFMPNPGMARDSYQLYP-WLLS-----------RHGRIFPHRFPGSFLVPPFR 386
            |.:.:.:.|..|.  || |....:..:|| |:.|           ||.:.......||  .....
 Worm    26 ATSPSSISPTFAS--PN-GTPNIASSMYPAWVFSTRYSDRPSAGPRHRKSRKRESTGS--SGSSE 85

  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            :.||.||||:..||.:|:..|..::|:....|:.||..|.|:|:|:|:||||:|.|.|:......
 Worm    86 EEKRPRTAFTGDQLDRLKTEFRESRYLTEKRRQELAHELGLNESQIKIWFQNKRAKLKKSTSSVP 150

  Fly   452 KGGEGGSQRNMHN 464
            :........|.||
 Worm   151 RDRCSSVTPNPHN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 23/51 (45%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.