DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and ceh-2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_491746.1 Gene:ceh-2 / 191615 WormBaseID:WBGene00000429 Length:209 Species:Caenorhabditis elegans


Alignment Length:173 Identity:77/173 - (44%)
Similarity:92/173 - (53%) Gaps:31/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 PHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPW---LLSRHG 369
            ||:      |||.:       .|..:...|:|    :.....|.|.....:| :||   |.|...
 Worm    62 PHV------QMACS-------NPFISGIGASG----SGDQNLNTGAGGSVWQ-HPWLELLQSTTA 108

  Fly   370 RIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKV 434
            ..|.....|.|| .|.||.||||||||.|||::||.|||.|.||||.|||.||..|:|:||||||
 Worm   109 AQFGDVTAGLFL-QPLRKNKRIRTAFSASQLIQLEKAFEGNHYVVGNERKQLAAKLSLTETQVKV 172

  Fly   435 WFQNRRTKHKRMQQEDEKGGEGGSQRN--MHNGSGDEDDDELI 475
            |||||||||||::.|       ||..|  |.|...||||.:.:
 Worm   173 WFQNRRTKHKRVRLE-------GSDPNAPMSNDEDDEDDKKSV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 39/51 (76%)
ceh-2NP_491746.1 Homeobox 130..182 CDD:278475 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I4406
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - otm14654
orthoMCL 1 0.900 - - OOG6_132317
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.670

Return to query results.
Submit another query.