DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Nkx2-9

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:69 Identity:33/69 - (47%)
Similarity:43/69 - (62%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRT 441
            |||   .|.::.|| |..||.:|.|:||..|...:|:...||:.||:.|.|:.||||:||||.|.
Mouse    74 PGS---DPEKRRKR-RVLFSKAQTLELERRFRQQRYLSAPEREQLARLLRLTPTQVKIWFQNHRY 134

  Fly   442 KHKR 445
            |.||
Mouse   135 KLKR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 27/55 (49%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 6/15 (40%)
Homeodomain 82..138 CDD:459649 27/56 (48%)

Return to query results.
Submit another query.