DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Nkx2-6

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:64 Identity:29/64 - (45%)
Similarity:41/64 - (64%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQE 449
            |..::.|..||.:|:|.||..|:..:|:...||:.||..|.|:.||||:||||||.|.|..:|:
Mouse   121 RPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTSTQVKIWFQNRRYKSKSQRQD 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 1/3 (33%)
Homeodomain 124..179 CDD:459649 26/54 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.