DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Nkx2-3

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_032725.1 Gene:Nkx2-3 / 18089 MGIID:97348 Length:362 Species:Mus musculus


Alignment Length:67 Identity:30/67 - (44%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 PPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQ 447
            |..|..::.|..||.:|:.:||..|:..:|:...||:.||.:|.|:.||||:||||||.|.||.:
Mouse   140 PKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQR 204

  Fly   448 QE 449
            |:
Mouse   205 QD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 25/55 (45%)
Nkx2-3NP_032725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..149 2/8 (25%)
Homeodomain 146..202 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..222 1/4 (25%)

Return to query results.
Submit another query.