DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Msx3

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034966.1 Gene:Msx3 / 17703 MGIID:106587 Length:204 Species:Mus musculus


Alignment Length:159 Identity:52/159 - (32%)
Similarity:70/159 - (44%) Gaps:44/159 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 QHNPHLIAAAQFQMAAALQAGHVLG----------PAAAAAAAAGLPPHAAQF---MPNPGMARD 356
            :|.|     ..|.:.:.|:|..|.|          |..|:...|..||.|...   .|:|.    
Mouse    22 EHGP-----LPFSVESLLEAERVPGSESGELGVERPLGASKPGAWPPPVAHSCPPRAPSPP---- 77

  Fly   357 SYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKAL 421
                 |..|.:|              ...|||   ||.|:.:|||.||..|...||:..|||...
Mouse    78 -----PCTLRKH--------------KTNRKP---RTPFTTAQLLALERKFHQKQYLSIAERAEF 120

  Fly   422 AQNLNLSETQVKVWFQNRRTKHKRMQQED 450
            :.:|:|:|||||:||||||.|.||:|:.:
Mouse   121 SSSLSLTETQVKIWFQNRRAKAKRLQEAE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 28/51 (55%)
Msx3NP_034966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..89 13/72 (18%)
Homeobox 90..143 CDD:278475 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.