DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and DLX5

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:185 Identity:51/185 - (27%)
Similarity:77/185 - (41%) Gaps:50/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 AQFQMAAALQAGHVLGPAAAAAAA--------AGLPPHAAQFMPNPGMARDSYQLYPWLLSRHG- 369
            |.||.:||:.......|....::|        .|..||.   ..:|..|.....|.|:....|| 
Human    19 APFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHG---YCSPTSASYGKALNPYQYQYHGV 80

  Fly   370 ----RIFP-------------HRFPGSF--------------LVPPFR----KPKRI---RTAFS 396
                ..:|             |::.|::              ..|..|    |||::   ||.:|
Human    81 NGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYS 145

  Fly   397 PSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            ..||..|:..|:..||:...||..||.:|.|::||||:||||:|:|.|::.:..|
Human   146 SFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/58 (45%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 7/29 (24%)
DLL_N 32..118 CDD:463567 14/88 (16%)
Homeodomain 138..194 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.