DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ems and DLX3

DIOPT Version :9

Sequence 1:	NP_731868.1	Gene:	ems / 41697	FlyBaseID:	FBgn0000576	Length:	494	Species:	Drosophila melanogaster
Sequence 2:	NP_005211.1	Gene:	DLX3 / 1747	HGNCID:	2916	Length:	287	Species:	Homo sapiens

Alignment Length:	81	Identity:	34/81 - (41%)
Similarity:	49/81 - (60%)	Gaps:	7/81 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   387 KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            |||::   ||.:|..||..|:..|:..||:...||..||..|.|::||||:||||||:|.|::.
Human   125 KPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLY- 188

  Fly   449 EDEKGGEGGSQRNMHN 464
               |.||...:.:.:|
Human   189 ---KNGEVPLEHSPNN 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ems	NP_731868.1	Homeobox	392..444	CDD:278475	26/51 (51%)
DLX3	NP_005211.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	20..39
		DLL_N	27..107	CDD:403572
		COG5576	<109..232	CDD:227863	34/81 (42%)
		homeobox	129..188		27/58 (47%)
		Homeobox	132..186	CDD:395001	26/53 (49%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	195..287		1/7 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0850
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810