DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and DLX2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:282 Identity:78/282 - (27%)
Similarity:103/282 - (36%) Gaps:102/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 LISSPHAT-----PPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPP--- 278
            |::..|:|     ....|.||||..         |||                   ||||..   
Human     8 LVADMHSTQIAASSTYHQHQQPPSG---------GGA-------------------GPGGNSSSS 44

  Fly   279 ----MPQGQPGLPDIKALPP--YINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAA 337
                .||..|.||...|...  |.|       |.:|                        |....
Human    45 SSLHKPQESPTLPVSTATDSSYYTN-------QQHP------------------------AGGGG 78

  Fly   338 AGLPPHA--------AQFMPN-PGMARDSYQL-YPWLLSRHGRIFPHRFPGS------FLVPPFR 386
            .|..|:|        |..:.| |..|:.||.| |....:.:........|.:      .|.|..|
Human    79 GGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEPEIR 143

  Fly   387 ----KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHK 444
                |||::   ||.:|..||..|:..|:..||:...||..||.:|.|::||||:||||||:|.|
Human   144 IVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFK 208

  Fly   445 RMQQEDEKGGEGGSQRNMHNGS 466
            :|.    |.||..|::  |.|:
Human   209 KMW----KSGEIPSEQ--HPGA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 26/51 (51%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 23/123 (19%)
DLL_N 51..132 CDD:289198 22/111 (20%)
Homeobox 155..208 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.