DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and NKX6-3

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:248 Identity:66/248 - (26%)
Similarity:90/248 - (36%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 MPPAGLVRPFPMGPGGPPMPQGQP-GLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQA 324
            :.|.||         ||.:..|.| |:.||.:.|  :.||........||:              
Human    38 LSPPGL---------GPQLAAGTPHGITDILSRP--VAAPNNSLLSGYPHV-------------- 77

  Fly   325 GHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYP-------------WLLSRHGRIFPHRF 376
                      |...||......:.|..|....:...||             |...|.....|...
Human    78 ----------AGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWRGGRQCSNTPDPL 132

  Fly   377 PGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRT 441
            ..|     ..|.|..|..|:..|:..||..||..:|:.|.||..||.:|.::|:|||||||||||
Human   133 SDS-----IHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRT 192

  Fly   442 KHKRMQQEDEK-------GGEGGSQRNMHNGSGDEDDDELIDMEMDECPSDEE 487
            |.::....:..       ||.|.........|.:|||:....::.|   ||:|
Human   193 KWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPD---SDDE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 27/51 (53%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.