DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Emx2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034262.2 Gene:Emx2 / 13797 MGIID:95388 Length:253 Species:Mus musculus


Alignment Length:318 Identity:100/318 - (31%)
Similarity:130/318 - (40%) Gaps:129/318 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SLKRERSPAPPAMEQAENPAQRIQPPHTPPKSVSPQSSQP---------------------SSSP 219
            ||..:.||.|.:  ::|:|.:        |.::|..:|.|                     .|:|
Mouse    14 SLVAKDSPLPAS--RSEDPIR--------PAALSYANSSPINPFLNGFHSAAAAAAAGRGVYSNP 68

  Fly   220 TLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPGGPPMPQGQP 284
            .|:.:...:.||.                          |.:|    |.|.|             
Mouse    69 DLVFAEAVSHPPN--------------------------PAVP----VHPVP------------- 90

  Fly   285 GLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMP 349
                    ||:..|...||..|:||.:.|:|                                  
Mouse    91 --------PPHALAAHPLPSSHSPHPLFASQ---------------------------------- 113

  Fly   350 NPGMARDSYQLYPWLLSRHGRIFPHRF------PGSFLV--PPFRKPKRIRTAFSPSQLLKLEHA 406
                .||....||||:.|: |...|||      |.|||:  ...||||||||||||||||:||||
Mouse   114 ----QRDPSTFYPWLIHRY-RYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHA 173

  Fly   407 FESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHN 464
            ||.|.||||||||.||.:|:|:||||||||||||||.||.:.|:|.......::..|:
Mouse   174 FEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
Emx2NP_034262.2 Homeobox 159..212 CDD:395001 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..253 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8781
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.