DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Emx1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:267 Identity:100/267 - (37%)
Similarity:119/267 - (44%) Gaps:67/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 SPQSSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMG 273
            ||.|....|.|..:.:|.....|...      |||     ||..|....:.|.|.|.........
Mouse    25 SPGSGGAGSHPLAVAASEEPLRPTAL------NYP-----HPSAAETAFVSGFPAAAAAGAGRSL 78

  Fly   274 PGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAA 338
            .|||.:           ..|..:|.|                   |..:...|.||.::..    
Mouse    79 YGGPEL-----------VFPEAMNHP-------------------ALTVHPAHQLGSSSLQ---- 109

  Fly   339 GLPPH---AAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRF-------PGSFLVPPF-RKPKRIR 392
              |||   :||.       ||....|||:|  ..|.|.|||       .|..|..|| |||||||
Mouse   110 --PPHSFFSAQH-------RDPLHFYPWVL--RNRFFGHRFQASDVPQDGLLLHGPFARKPKRIR 163

  Fly   393 TAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGG 457
            |||||||||:||.|||.|.||||||||.||.:|:||||||||||||||||:||.:.|:|......
Mouse   164 TAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQ 228

  Fly   458 SQRNMHN 464
            .::..|:
Mouse   229 KKKGSHH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 71/124 (57%)
Homeobox 163..215 CDD:278475 43/51 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm8781
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.