DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Dlx4

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:248 Identity:63/248 - (25%)
Similarity:91/248 - (36%) Gaps:87/248 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PAMMHPGGAGPMMMPGMPPA-GLVRPFPMG--PG-------------GPPMPQGQPG--LPDIKA 291
            |..:...||..::.|.:.|| .:|..:|:|  ||             |.|.....||  .|....
Mouse     5 PCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSY 69

  Fly   292 LP--PYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMA 354
            ||  ..:.||.:  |.|.|               |.|   |....|.:..|   |...:|:...:
Mouse    70 LPRQQQLVAPSQ--PFHRP---------------AEH---PQELEAESEKL---ALSLVPSQQQS 111

  Fly   355 RDSYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERK 419
                                      |....|||   ||.:|..||..|...|:..||:...||.
Mouse   112 --------------------------LTRKLRKP---RTIYSSLQLQHLNQRFQHTQYLALPERA 147

  Fly   420 ALAQNLNLSETQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHNGSGDEDDD 472
            .||..|.|::||||:||||:|:|:|::               :...||:.::|
Mouse   148 QLAAQLGLTQTQVKIWFQNKRSKYKKL---------------LKQSSGEPEED 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 25/51 (49%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 5/25 (20%)
Homeobox 119..172 CDD:278475 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.