Protein Alignment ems and Dlx3

DIOPT Version :9

• Sequence 1: NP_731868.1
• Gene: ems / 41697
• FlyBaseID: FBgn0000576
• Length: 494
• Species: Drosophila melanogaster
• Sequence 2: NP_034185.1
• Gene: Dlx3 / 13393
• MGIID: 94903
• Length: 287
• Species: Mus musculus
• Alignment Length: 81
• Identity: 34/81 - (41%)
• Similarity: 49/81 - (60%)
• Gaps: 7/81 - (8%)

  Fly   387 KPKRI---RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            |||::   ||.:|..||..|:..|:..||:...||..||..|.|::||||:||||||:|.|::.
Mouse   125 KPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLY- 188

  Fly   449 EDEKGGEGGSQRNMHN 464
               |.||...:.:.:|
Mouse   189 ---KNGEVPLEHSPNN 201

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
ems	NP_731868.1	Homeobox	392..444	CDD:278475	26/51 (51%)
Dlx3	NP_034185.1	DLL_N	27..107	CDD:315147
		Abdominal-A	<109..224	CDD:332641	34/81 (42%)
		Interaction with DNA. /evidence=ECO:0000250|UniProtKB:O60479	131..181		23/49 (47%)
		Homeobox	132..185	CDD:306543	26/52 (50%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	195..287		1/7 (14%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0850
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810