DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and Cdx4

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus


Alignment Length:283 Identity:70/283 - (24%)
Similarity:103/283 - (36%) Gaps:83/283 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGG--AGPMMMPGMPPAGLVRPFPMGP 274
            |..|:|:.|.....||..           .||..:.|.|.|  .|....|..||......:|   
Mouse    37 SPLPASNFTAAPVYPHYV-----------GYPHMSNMDPHGPSLGAWSSPYSPPREDWSTYP--- 87

  Fly   275 GGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGHVLGPAAAAAAAAG 339
             |||...|...:.|:.:  |...:|..                        ..|||.:.|:....
Mouse    88 -GPPSTMGTVPMNDMTS--PVFGSPDY------------------------STLGPTSGASNGGS 125

  Fly   340 LPPHAAQFM----------PNPGMARDSYQLYPWL---LSRHGRIFPHRFPGSFLVPPFRKPKRI 391
            ||..|::.:          .:|..:|.|  .|.|:   :...|:.              |..::.
Mouse   126 LPDAASESLVSLDSGTSGATSPSRSRHS--PYAWMRKTVQVTGKT--------------RTKEKY 174

  Fly   392 RTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRM-----QQEDE 451
            |..::..|.|:||..|..|:|:....:..||.||.|||.|||:||||||.|.::|     .|.:.
Mouse   175 RVVYTDHQRLELEKEFHCNRYITIRRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFEN 239

  Fly   452 KGGEGGSQRNMHNGSGDEDDDEL 474
            .||      ::.:.||.....||
Mouse   240 TGG------SVQSDSGSISPGEL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 25/51 (49%)
Cdx4NP_031700.1 Caudal_act 13..160 CDD:309740 35/165 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156 13/85 (15%)
Homeobox 175..227 CDD:306543 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.