DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and CDX1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001795.2 Gene:CDX1 / 1044 HGNCID:1805 Length:265 Species:Homo sapiens


Alignment Length:260 Identity:70/260 - (26%)
Similarity:94/260 - (36%) Gaps:98/260 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PNYPKPAMMHPGGAGPMMMPGMPPAGLVRPFPMGPG----GPPMPQGQPGLPDIKALPPYINAPP 300
            |.||.||                     ||..:|.|    |||.|            ||   |||
Human    12 PVYPGPA---------------------RPASLGLGPQAYGPPAP------------PP---APP 40

  Fly   301 ELP---------PQHNPHLIAAAQF-----QMAAALQAGHVLGPAAAAAAAAGLPPHAAQF--MP 349
            :.|         |...|.....|.|     ..|||...|.....|:.|:.|.|.||..:..  .|
Human    41 QYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPP 105

  Fly   350 NPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPPFRKP------------------------KR 390
            .||         |.||::     |...||:...|..::|                        .:
Human   106 GPG---------PGLLAQ-----PLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDK 156

  Fly   391 IRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTK----HKRMQQEDE 451
            .|..::..|.|:||..|..::|:....:..||.||.|:|.|||:||||||.|    :|:.||:.:
Human   157 YRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQ 221

  Fly   452  451
            Human   222  221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 23/55 (42%)
CDX1NP_001795.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 9..153 44/190 (23%)
Caudal_act 13..138 CDD:282574 43/174 (25%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 157..178 6/20 (30%)
Homeobox 158..210 CDD:278475 23/51 (45%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 196..207 8/10 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..265 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.