DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and nkx1-1

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002936812.1 Gene:nkx1-1 / 100493120 XenbaseID:XB-GENE-488879 Length:408 Species:Xenopus tropicalis


Alignment Length:82 Identity:41/82 - (50%)
Similarity:53/82 - (64%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ-ED 450
            ||:|.||||:..||:.||:.|:|.:|:...||..||.:|:|:|||||:||||||||.|:... .|
 Frog   256 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 320

  Fly   451 EKGGEGGSQRNMHNGSG 467
            .....|||.   |.|.|
 Frog   321 TSAPTGGSG---HGGGG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 30/51 (59%)
nkx1-1XP_002936812.1 Homeobox 261..314 CDD:365835 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.