DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and shox

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:70 Identity:31/70 - (44%)
Similarity:43/70 - (61%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 KPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQEDE 451
            |.:|.||.|:..||.:||..|:...|.....|:.|:|.|.|||.:|:|||||||.|.::.:.:..
 Frog   155 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMH 219

  Fly   452 KGGEG 456
            |||.|
 Frog   220 KGGYG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
shoxXP_004911874.1 Homeodomain 157..213 CDD:459649 26/55 (47%)
OAR 314..330 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.