DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and arxb

DIOPT Version :10

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:63 Identity:28/63 - (44%)
Similarity:41/63 - (65%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKHKRMQQ 448
            ||.:|.||.|:..||.:||.||:...|.....|:.||..|:|:|.:|:|||||||.|.::.::
Zfish   160 RKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeodomain 389..445 CDD:459649 26/55 (47%)
arxbXP_002667096.1 Homeodomain 163..219 CDD:459649 26/55 (47%)
OAR 351..369 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.