DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and dlx6

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001135678.1 Gene:dlx6 / 100216239 XenbaseID:XB-GENE-853184 Length:211 Species:Xenopus tropicalis


Alignment Length:121 Identity:27/121 - (22%)
Similarity:46/121 - (38%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QTPPATLTLIPGSPPHHLMAPPAHGLPYPHPHAQQ--------QHLQAPHPHPHLSPAQQHVLHQ 122
            |:.|   .:..|..|.|.:...:|  |:.|||.||        .:.::...:|::|.:|.....|
 Frog    33 QSSP---VMAAGHYPLHCLHSGSH--PHHHPHHQQHDSYSGSNSYSRSLAAYPYMSHSQHSPYLQ 92

  Fly   123 HLLMQQQHPGTPKSHQDIQELLQRLHHNAAMASGL--------------SPLQTRL 164
            ..........|.:|.  ::|..:..|::.:.|.|.              ||||..|
 Frog    93 SYSSNSSSSTTTQSR--VEEPGEAEHYSFSAAPGAPLLLLPWGRCYTLQSPLQMHL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475
dlx6NP_001135678.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.