DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and emx1l

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002936883.1 Gene:emx1l / 100101663 XenbaseID:XB-GENE-876649 Length:213 Species:Xenopus tropicalis


Alignment Length:260 Identity:94/260 - (36%)
Similarity:107/260 - (41%) Gaps:104/260 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 GPMMMPGMP--PAGLVRPFPMGPGGPPMPQGQPGL-----PDI----KALPPYINAPPELPPQHN 307
            ||...|..|  |..|..|.| |.|..|.|. :||:     ||:    .|.|||            
 Frog    17 GPDRTPEEPLRPTALKYPEP-GHGLTPTPL-RPGVRLLGAPDLFFPEPAAPPY------------ 67

  Fly   308 PHLIAAAQFQMAAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIF 372
                                 ||      :.|||.|..       :.||.....||:|.      
 Frog    68 ---------------------GP------SLGLPQHRI-------LHRDPLSFCPWILR------ 92

  Fly   373 PHRFPGSFLVP-------PF-RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSE 429
             ||.||....|       || ||||||||||||||||:||.|||.|.||||||||.||.:|.|:|
 Frog    93 -HRLPGEENTPDNYLLHGPFSRKPKRIRTAFSPSQLLRLEGAFEKNHYVVGAERKQLANSLCLTE 156

  Fly   430 TQVKVWFQNRRTKHKRMQQEDEKGGEGGSQRNMHNGSGDEDDDELIDMEMDECPSDEEHELDASH 494
            ||||||||||||||||.:.|                              :|||..::......|
 Frog   157 TQVKVWFQNRRTKHKRQKLE------------------------------EECPESQQKRKSTQH 191

  Fly   495  494
             Frog   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 42/51 (82%)
emx1lXP_002936883.1 Homeobox 119..172 CDD:365835 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9445
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.