DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and nkx6-2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_002937836.1 Gene:nkx6-2 / 100038084 XenbaseID:XB-GENE-484527 Length:281 Species:Xenopus tropicalis


Alignment Length:245 Identity:74/245 - (30%)
Similarity:102/245 - (41%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 PAGLVRPFPMGPG----GPPMPQGQP-GLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAAL 322
            |..|..|....||    ...:|.|.| |:.||      ::.|.......:.:|:::.......|.
 Frog    37 PYALQNPSFKAPGLSSLSAQIPLGTPHGISDI------LSRPLGATLGSSANLLSSLPRINGLAT 95

  Fly   323 QAGHVLGPAAAA---AAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPP 384
            ..|....|||.:   ...|.||..|..|.  ||:.:.|    ||...|.|  .|.:  ...::..
 Frog    96 STGMYFNPAAVSRYPKPLAELPGRAPIFW--PGVMQGS----PWRDPRLG--CPSQ--AGMVLDK 150

  Fly   385 FRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTK------- 442
            ..|.|..|..||..|:..||..||..:|:.|.||..||.:|.::|:||||||||||||       
 Frog   151 DGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAA 215

  Fly   443 -----HKRMQQEDEKGGEGGSQRNMHNGSGDEDDDELIDMEMDECPSDEE 487
                 .|:...|.||         |...|.:|:||| .:..:|....||:
 Frog   216 EMATAKKKHDSETEK---------MKESSENEEDDE-YNKPLDPNSDDEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 28/63 (44%)
nkx6-2XP_002937836.1 Homeobox 157..211 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.