DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and emx2

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001128284.1 Gene:emx2 / 100038069 XenbaseID:XB-GENE-481028 Length:247 Species:Xenopus tropicalis


Alignment Length:308 Identity:109/308 - (35%)
Similarity:138/308 - (44%) Gaps:88/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 QPPHTPPKSVSPQSSQPSSSPTLLISSPHATPPQQQQQQPPPNYPKPAMMHPGGAGPM--MMPGM 261
            ||  ||.:..:.:|.....||.          |..:.::|    .:||.:....:.||  .:.|.
 Frog     3 QP--TPKRCFTIESLVAKDSPL----------PVSRSEEP----IRPAALSYANSAPMNPFLNGF 51

  Fly   262 PPAG--------LVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQM 318
            .|.|        ||  |......||    .|.:|.....||:..|...||..|:||.:.|:|   
 Frog    52 HPTGRGVYSNPDLV--FAEAVSHPP----NPAVPVHPVPPPHALAAHPLPTSHSPHPLFASQ--- 107

  Fly   319 AAALQAGHVLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPG----- 378
                                               .||....||||:.|: |...|||.|     
 Frog   108 -----------------------------------QRDPSTFYPWLIHRY-RYLGHRFQGNDTSA 136

  Fly   379 -SFLV--PPFRKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRR 440
             |||:  ...||||||||||||||||:||||||.|.||||||||.||.:|:|:||||||||||||
 Frog   137 ESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRR 201

  Fly   441 TKHKRMQQEDEKGGEGGSQR-------NMHNGSGDEDDDELIDMEMDE 481
            ||.||.:.|:|  |...||:       |....:..:...|.||:..|:
 Frog   202 TKFKRQKLEEE--GSDSSQKKKGAHHINRWRLATKQASPEEIDVTSDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 43/51 (84%)
emx2NP_001128284.1 Homeobox 153..206 CDD:365835 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000921
OrthoInspector 1 1.000 - - mtm9445
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.