DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ems and cdx1b

DIOPT Version :9

Sequence 1:NP_731868.1 Gene:ems / 41697 FlyBaseID:FBgn0000576 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001092232.1 Gene:cdx1b / 100004956 ZFINID:ZDB-GENE-070615-29 Length:255 Species:Danio rerio


Alignment Length:263 Identity:65/263 - (24%)
Similarity:92/263 - (34%) Gaps:89/263 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 SSQPSS--SPTLLISSPHATPPQQQQQQPPPNYPKPAMMH--PG-----------GAGPMMMPGM 261
            |..|:|  .|:|.::..:..|       .||.||.....|  ||           |:.....|  
Zfish    12 SMYPNSVRHPSLNLNPQNFVP-------APPQYPDFTGYHHVPGITTNDPHHSQTGSWNPAYP-- 67

  Fly   262 PPAGLVRPFPMGPGGPPMPQGQPGLPDIKALPPYINAPPELPPQHNPHLIAAAQFQMAAALQAGH 326
            ||.....|:..|.|......||.|.           :|||......|.|:               
Zfish    68 PPREEWTPYGPGSGVSSSSTGQLGF-----------SPPEFSSVQTPGLL--------------- 106

  Fly   327 VLGPAAAAAAAAGLPPHAAQFMPNPGMARDSYQLYPWLLSRHGRIFPHRFPGSFLVPP------F 385
               .::..::...|.|:|.:..|           |.|:...              |||      .
Zfish   107 ---QSSINSSVGQLSPNAQRRNP-----------YDWMRRS--------------VPPASSGGKT 143

  Fly   386 RKPKRIRTAFSPSQLLKLEHAFESNQYVVGAERKALAQNLNLSETQVKVWFQNRRTKH-----KR 445
            |...:.|..::..|.|:||..|..::|:....:..||..|:|||.|||:||||||.|.     |:
Zfish   144 RTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELATALSLSERQVKIWFQNRRAKERKINKKK 208

  Fly   446 MQQ 448
            |||
Zfish   209 MQQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
emsNP_731868.1 Homeobox 392..444 CDD:278475 23/56 (41%)
cdx1bNP_001092232.1 Caudal_act 13..132 CDD:282574 33/167 (20%)
Homeobox 150..202 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.